PDB entry 1dgm

View 1dgm on RCSB PDB site
Description: crystal structure of adenosine kinase from toxoplasma gondii
Class: transferase
Keywords: toxoplasma gondii, adenosine kinase, purine metabolism, transferase
Deposited on 1999-11-24, released 2000-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TVW2 (Start-362)
      • engineered (178)
    Domains in SCOPe 2.07: d1dgma_
  • Heterogens: MG, CL, ADN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgmA (A:)
    mavdssnsatgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldq
    fnptslpggsalnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvap
    gqstgvcavlinekertlcthlgacgsfrlpedwttfasgalifyataytltatpknafe
    vagyahgipnaiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaae
    ktalstankehavevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhev
    gvpvvaaekivdtngagdafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsfts
    lpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgmA (A:)
    tgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpgg
    salnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgvcav
    linekertlcthlgacgsfrlpedwttfasgalifyataytltatpknafevagyahgip
    naiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvtankehavevct
    galrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngag
    dafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsftslpc