PDB entry 1dgl

View 1dgl on RCSB PDB site
Description: lectin from dioclea grandiflora complexed to trimannoside
Class: lectin
Keywords: lectin, saccharide binding, trimannoside
Deposited on 1998-02-10, released 1999-06-01
The last revision prior to the SCOP 1.73 freeze date was dated 1999-06-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: DIOCLEA GRANDIFLORA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08902 (0-236)
      • conflict (9)
      • conflict (130)
      • conflict (183)
      • conflict (195)
      • conflict (203)
    Domains in SCOP 1.73: d1dgla_
  • Chain 'B':
    Compound: lectin
    Species: DIOCLEA GRANDIFLORA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08902 (0-236)
      • conflict (9)
      • conflict (130)
      • conflict (183)
      • conflict (195)
      • conflict (203)
    Domains in SCOP 1.73: d1dglb_
  • Heterogens: CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dglA (A:)
    adtivavelnsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
    lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
    adanslhfsfhqfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
    iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dglB (B:)
    adtivavelnsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
    lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
    adanslhfsfhqfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
    iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan