PDB entry 1dgl

View 1dgl on RCSB PDB site
Description: lectin from dioclea grandiflora complexed to trimannoside
Deposited on 1998-02-10, released 1999-06-01
The last revision prior to the SCOP 1.67 freeze date was dated 1999-06-01, with a file datestamp of 1999-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1dgla_
  • Chain 'B':
    Domains in SCOP 1.67: d1dglb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dglA (A:)
    adtivavelnsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
    lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
    adanslhfsfhqfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
    iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dglB (B:)
    adtivavelnsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
    lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
    adanslhfsfhqfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
    iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan