PDB entry 1dgj

View 1dgj on RCSB PDB site
Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774
Class: oxidoreductase
Keywords: beta half-barrel, four-helix bundle, beta barrel, oxidoreductase
Deposited on 1999-11-24, released 2000-03-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.164
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde oxidoreductase
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dgja1, d1dgja2, d1dgja3, d1dgja4
  • Heterogens: FES, 2MO, MCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgjA (A:)
    metktlivngmarrllvspndllvdvlrsqlqltsvkvgcgkgqcgactvildgkvvrac
    iikmsrvaenasvttlegigapdclhplqhawiqhgaaqcgfctpgfivsakalldenva
    psredvrdwfqkhhnicrctgykplvdavmdaaailrgektveeisfkmpadgriwgssi
    prpsavakvtglaefgadaalrmpentlhlalaqakvshalikgidtseaekmpgvykvl
    thkdvkgknritglitfptnkgdgwerpilndskifqygdalaivcadseanaraaaekv
    kfdlellpeymsapeamapdaieihpgtpnvyydqleekgedtvpffndpanvvaegsyy
    tqrqphlpiepdvgygyineqgqvvihsksvaihlhalmiapglglefpkdlvlvqnttg
    gtfgykfsptmealvgvavmatgrpchlrynyeqqqnytgkrspfwttmryaadrqgkil
    ametdwsvdhgpysefgdlltlrgaqyigagygianirgtgrtvatnhcwgaafrgygap
    esefpsevlmdelaeklgmdpfelralncyregdttssgqipevmslpemfdkmrpyyee
    skkrvkerstaeikrgvgvalgvygagldgpdtseawvelnddgsvtlgnswedhgqgad
    agslgtahealrplgitpenihlvmndtsktpnsgpaggsrsqvvtgnairvacemlieg
    mrkpgggfftpaemkaegrpmrydgkwtapakdcdakgqgspfacymyglfltevaveva
    tgkatvekmvcvadigkicnklvvdgqiygglaqgvglalsedyedlkkhstmggagips
    ikmipddieivyvetprkdgpfgasgvgempltaphaaiingiynacgarvrhlparpek
    vleampr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgjA (A:)
    metktlivngmarrllvspndllvdvlrsqlqltsvkvgcgkgqcgactvildgkvvrac
    iikmsrvaenasvttlegigapdclhplqhawiqhgaaqcgfctpgfivsakalldenva
    psredvrdwfqkhhnicrctgykplvdavmdaaailrgektveeisfkmpadgriwgssi
    prpsavakvtglaefgadaalrmpentlhlalaqakvshalikgidtseaekmpgvykvl
    thkdvkgknritglitfptnkgdgwerpilndskifqygdalaivcadseanaraaaekv
    kfdlellpeymsapeamapdaieihpgtpnvyydqleekgedtvpffndpanvvaegsyy
    tqrqphlpiepdvgygyineqgqvvihsksvaihlhalmiapglglefpkdlvlvqnttg
    gtfgykfsptmealvgvavmatgrpchlrynyeqqqnytgkrspfwttmryaadrqgkil
    ametdwsvdhgpysefgdlltlrgaqyigagygianirgtgrtvatnhcwgaafrgygap
    esefpsevlmdelaeklgmdpfelralncyregdttssgqipevmslpemfdkmrpyyee
    skkrvkerstaeikrgvgvalgvygagldgpdtseawvelnddgsvtlgnswedhgqgad
    agslgtahealrplgitpenihlvmndtsktpnsgpaggsrsqvvtgnairvacemlieg
    mrkpgggfftpaemkaegrpmrydgkwtapakdcdakgqgspfacymyglfltevaveva
    tgkatvekmvcvadigkicnklvvdgqiygglaqgvglalsedyedlkkhstmggagips
    ikmipddieivyvetprkdgpfgasgvgempltaphaaiingiynacgarvrhlparpek
    vleamp