PDB entry 1dgj

View 1dgj on RCSB PDB site
Description:
Deposited on 1999-11-24, released 2000-03-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-22, with a file datestamp of 2000-03-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.164
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgjA (A:)
    metktlivngmarrllvspndllvdvlrsqlqltsvkvgcgkgqcgactvildgkvvrac
    iikmsrvaenasvttlegigapdclhplqhawiqhgaaqcgfctpgfivsakalldenva
    psredvrdwfqkhhnicrctgykplvdavmdaaailrgektveeisfkmpadgriwgssi
    prpsavakvtglaefgadaalrmpentlhlalaqakvshalikgidtseaekmpgvykvl
    thkdvkgknritglitfptnkgdgwerpilndskifqygdalaivcadseanaraaaekv
    kfdlellpeymsapeamapdaieihpgtpnvyydqleekgedtvpffndpanvvaegsyy
    tqrqphlpiepdvgygyineqgqvvihsksvaihlhalmiapglglefpkdlvlvqnttg
    gtfgykfsptmealvgvavmatgrpchlrynyeqqqnytgkrspfwttmryaadrqgkil
    ametdwsvdhgpysefgdlltlrgaqyigagygianirgtgrtvatnhcwgaafrgygap
    esefpsevlmdelaeklgmdpfelralncyregdttssgqipevmslpemfdkmrpyyee
    skkrvkerstaeikrgvgvalgvygagldgpdtseawvelnddgsvtlgnswedhgqgad
    agslgtahealrplgitpenihlvmndtsktpnsgpaggsrsqvvtgnairvacemlieg
    mrkpgggfftpaemkaegrpmrydgkwtapakdcdakgqgspfacymyglfltevaveva
    tgkatvekmvcvadigkicnklvvdgqiygglaqgvglalsedyedlkkhstmggagips
    ikmipddieivyvetprkdgpfgasgvgempltaphaaiingiynacgarvrhlparpek
    vleamp