PDB entry 1dgh

View 1dgh on RCSB PDB site
Description: human erythrocyte catalase 3-amino-1,2,4-triazole complex
Class: oxidoreductase
Keywords: catalase, heme, nadph, hydrogen peroxide, 3-amino-1,2,4-triazole, inhibitor, oxidoreductase
Deposited on 1999-11-24, released 2000-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (catalase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dgha_
  • Chain 'B':
    Compound: protein (catalase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04040 (0-497)
      • modified residue (71)
    Domains in SCOPe 2.08: d1dghb_
  • Chain 'C':
    Compound: protein (catalase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dghc_
  • Chain 'D':
    Compound: protein (catalase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04040 (0-497)
      • modified residue (71)
    Domains in SCOPe 2.08: d1dghd_
  • Heterogens: HEM, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dghA (A:)
    srdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
    nlsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvw
    phkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthr
    hrlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsi
    qysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknft
    evhpdygshiqalldkyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dghA (A:)
    rdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemahf
    dreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsad
    tvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwd
    fwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgikn
    lsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwp
    hkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrh
    rlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiq
    ysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknfte
    vhpdygshiqalldkyn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dghB (B:)
    srdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
    nlsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvw
    phkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthr
    hrlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsi
    qysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknft
    evhpdygshiqalldkyn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dghC (C:)
    srdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
    nlsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvw
    phkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthr
    hrlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsi
    qysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknft
    evhpdygshiqalldkyn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dghD (D:)
    srdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
    nlsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvw
    phkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthr
    hrlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsi
    qysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknft
    evhpdygshiqalldkyn