PDB entry 1dgg

View 1dgg on RCSB PDB site
Description: human erythrocyte catalse cyanide complex
Deposited on 1999-11-24, released 2000-02-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-17, with a file datestamp of 2000-02-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dgga_
  • Chain 'B':
    Domains in SCOP 1.55: d1dggb_
  • Chain 'C':
    Domains in SCOP 1.55: d1dggc_
  • Chain 'D':
    Domains in SCOP 1.55: d1dggd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dggA (A:)
    rdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemahf
    dreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsad
    tvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwd
    fwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgikn
    lsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwp
    hkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrh
    rlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiq
    ysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknfte
    vhpdygshiqalldkyn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dggB (B:)
    rdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemahf
    dreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsad
    tvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwd
    fwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgikn
    lsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwp
    hkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrh
    rlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiq
    ysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknfte
    vhpdygshiqalldkyn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dggC (C:)
    rdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemahf
    dreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsad
    tvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwd
    fwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgikn
    lsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwp
    hkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrh
    rlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiq
    ysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknfte
    vhpdygshiqalldkyn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dggD (D:)
    rdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemahf
    dreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsad
    tvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwd
    fwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgikn
    lsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwp
    hkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrh
    rlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiq
    ysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknfte
    vhpdygshiqalldkyn