PDB entry 1dge

View 1dge on RCSB PDB site
Description: an alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase
Class: lyase
Keywords: lyase
Deposited on 1994-06-29, released 1994-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dialkylglycine decarboxylase
    Species: Burkholderia cepacia [TaxId:292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16932 (Start-431)
      • conflict (13)
    Domains in SCOPe 2.07: d1dgea_
  • Heterogens: RB, PLP, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgeA (A:)
    slnddatfwrnarhhlvryggtfepmiierakgsfvydadgraildftsgqmsavlghch
    peivsvigeyagkldhlfsgmlsrpvvdlatrlanitppgldralllstgaesneaairm
    aklvtgkyeivgfaqswhgmtgaaasatysagrkgvgpaavgsfaipapftyrprferng
    aydylaeldyafdlidrqssgnlaafiaepilssggiielpdgymaalkrkceargmlli
    ldeaqtgvgrtgtmfacqrdgvtpdiltlsktlgaglplaaivtsaaieerahelgylfy
    tthvsdplpaavglrvldvvqrdglvaranvmgdrlrrglldlmerfdcigdvrgrglll
    gveivkdrrtkepadglgakitrecmnlglsmnivqlpgmggvfriappltvsedeidlg
    lsllgqaieral
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgeA (A:)
    lnddatfwrnarhhlvryggtfepmiierakgsfvydadgraildftsgqmsavlghchp
    eivsvigeyagkldhlfsgmlsrpvvdlatrlanitppgldralllstgaesneaairma
    klvtgkyeivgfaqswhgmtgaaasatysagrkgvgpaavgsfaipapftyrprfernga
    ydylaeldyafdlidrqssgnlaafiaepilssggiielpdgymaalkrkceargmllil
    deaqtgvgrtgtmfacqrdgvtpdiltlsktlgaglplaaivtsaaieerahelgylfyt
    thvsdplpaavglrvldvvqrdglvaranvmgdrlrrglldlmerfdcigdvrgrglllg
    veivkdrrtkepadglgakitrecmnlglsmnivqlpgmggvfriappltvsedeidlgl
    sllgqaieral