PDB entry 1dgc

View 1dgc on RCSB PDB site
Description: the x-ray structure of the gcn4-bzip bound to atf/creb site dna shows the complex depends on dna flexibility
Deposited on 1993-07-15, released 1994-06-22
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: -
Resolution: 3 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (gcn4)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*gp*ap*gp*ap*tp*gp*ap*cp*gp*tp*cp*ap*tp*cp*t p*cp*c)-3')

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.57, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1dgcA (A:)
ivpessdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvg
er

    Sequence, based on observed residues (ATOM records):
    >1dgcA (A:)
paalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvger

  • Chain 'B':
    No sequence available.