PDB entry 1dg9

View 1dg9 on RCSB PDB site
Description: crystal structure of bovine low molecular weight ptpase complexed with hepes
Class: hydrolase
Keywords: ptpase, hepes complex, hydrolase
Deposited on 1999-11-23, released 1999-12-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tyrosine phosphatase
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11064 (0-156)
  Domains in SCOPe 2.02: d1dg9a_
• Heterogens: EPE

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dg9A (A:)
  aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
  sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
  pqkqliiedpyygndadfetvyqqcvrccraflekvr