PDB entry 1dg9

View 1dg9 on RCSB PDB site
Description: crystal structure of bovine low molecular weight ptpase complexed with hepes
Deposited on 1999-11-23, released 1999-12-08
The last revision prior to the SCOP 1.69 freeze date was dated 1999-12-08, with a file datestamp of 1999-12-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1dg9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dg9A (A:)
    aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
    sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
    pqkqliiedpyygndadfetvyqqcvrccraflekvr