PDB entry 1dg6

View 1dg6 on RCSB PDB site
Description: crystal structure of apo2l/trail
Class: apoptosis
Keywords: cytokine, tnf, trimer, zinc-binding site, apoptosis
Deposited on 1999-11-23, released 2000-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.141
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apo2l/tnf-related apopotis inducing ligand (trail)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50591 (Start-190)
      • mutation (127)
    Domains in SCOPe 2.07: d1dg6a_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dg6A (A:)
    milrtseetistvqekqqnisplvrergpqrvaahitgtrgrsntlsspnsknekalgrk
    inswessrsghsflsnlhlrngelvihekgfyyiysqtyfrfqeeikentkndkqmvqyi
    ykytsypapillmksarnscwskdaeyglysiyqggifelkendrifvsvtnehlidmdh
    easffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dg6A (A:)
    qrvaahitgtrknekalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqtyf
    rfqekentkndkqmvqyiykytsypapillmksarnscwskdaeyglysiyqggifelke
    ndrifvsvtnehlidmdheasffgaflvg