PDB entry 1dg4

View 1dg4 on RCSB PDB site
Description: nmr structure of the substrate binding domain of dnak in the apo form
Class: chaperone
Keywords: dnak, chaperone, substrate binding domain
Deposited on 1999-11-23, released 1999-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dnak
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dg4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1dg4A (A:)
dvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkraadnk
slgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgl

    Sequence, based on observed residues (ATOM records): (download) 
    >1dg4A (A:)
lslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkraadnkslgq
fnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgl