PDB entry 1dg3

View 1dg3 on RCSB PDB site
Description: structure of human guanylate binding protein-1 in nucleotide free form
Class: signaling protein
Keywords: gbp, GTP hydrolysis, GDP, gmp, interferon induced, dynamin related, large gtpase family, signaling protein
Deposited on 1999-11-23, released 2000-02-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.242
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (interferon-induced guanylate-binding protein 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32455
      • expression artifact (506)
    Domains in SCOPe 2.01: d1dg3a1, d1dg3a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dg3A (A:)
    maseihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklag
    kkkgfslgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalav
    llsstfvynsigtinqqamdqlyyvtelthrirsksspdenenevedsadfvsffpdfvw
    tlrdfsldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdr
    pvhrrklaqleklqdeeldpefvqqvadfcsyifsnsktktlsggiqvngprleslvlty
    vnaissgdlpcmenavlalaqiensaavqkaiahyeqqmgqkvqlpteslqelldlhrds
    ereaievfirssfkdvdhlfqkelaaqlekkrddfckqnqeassdrcsgllqvifsplee
    evkagiyskpggyrlfvqklqdlkkkyyeeprkgiqaeeilqtylkskesmtdailqtdq
    tltekekeievervkaesaqasakmlhemqrkneqmmeqkersyqehlkqltekmendrv
    qllkeqertlalklqeqeqllkegfqkesrimkneiqdlqtkmrrrkactis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dg3A (A:)
    hmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkhtk
    giwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsstfvynsigtinq
    qamdqlyyvtelthrirsksdsadfvsffpdfvwtlrdfsldlqpltpdeyltyslklkk
    gtsqkdetfnlprlcirkffpkkkcfvfdrpvheldpefvqqvadfcsyifsnsktktls
    ggiqvngprleslvltyvnaissgdlpcmenavlalaqiensaavqkaiahyeqqmgqkv
    qlpteslqelldlhrdsereaievfirssfkdvdhlfqkelaaqlekkrddfckqnqeas
    sdrcsgllqvifspleeevkagiyskpggyrlfvqklqdlkkkyyeeprkgiqaeeilqt
    ylkskesmtdailqtdqtltekekeievervkaesaqasakmlhemqrkneqmmeqkers
    yqehlkqltekmendrvqllkeqertlalklqeqeqllkegfqkesrimkneiqdlqtkm