PDB entry 1dfx

View 1dfx on RCSB PDB site
Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774
Class: electron transport
Keywords: electron transport, non-heme iron protein
Deposited on 1997-09-03, released 1998-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: desulfoferrodoxin
  Species: Desulfovibrio desulfuricans [TaxId:876]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22076 (0-124)
  Domains in SCOPe 2.02: d1dfxa1, d1dfxa2
• Heterogens: FE, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dfxA (A:)
  pkhlevykcthcgnivevlhgggaelvccgepmkhmvegstdgamekhvpviekvdggyl
  ikvgsvphpmeekhwiewielladgrsytkflkpgdapeaffaidaskvtareycnlhgh
  wkaen