PDB entry 1dfx

View 1dfx on RCSB PDB site
Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774
Class: electron transport
Keywords: electron transport, non-heme iron protein
Deposited on 1997-09-03, released 1998-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: desulfoferrodoxin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1dfxa1, d1dfxa2
  • Heterogens: FE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfxA (A:)
    pkhlevykcthcgnivevlhgggaelvccgepmkhmvegstdgamekhvpviekvdggyl
    ikvgsvphpmeekhwiewielladgrsytkflkpgdapeaffaidaskvtareycnlhgh
    wkaen