PDB entry 1dfv

View 1dfv on RCSB PDB site
Description: crystal structure of human neutrophil gelatinase associated lipocalin monomer
Class: sugar binding protein
Keywords: neutrophil, ngal, lipocalin, sugar binding protein
Deposited on 1999-11-22, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.281
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human neutrophil gelatinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfva_
  • Chain 'B':
    Compound: human neutrophil gelatinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfvb_
  • Heterogens: NDG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dfvA (A:)
    qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
    dksynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqham
    vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfvA (A:)
    sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
    nvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqhamvffk
    kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dfvB (B:)
    qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
    dksynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqham
    vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfvB (B:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
    ynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqhamvff
    kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid