PDB entry 1dfr

View 1dfr on RCSB PDB site
Description: interpretation of nuclear magnetic resonance spectra for lactobacillus casei dihydrofolate reductase based on the x-ray structure of the enzyme-*methotrexate-/nadph$ complex
Deposited on 1980-03-17, released 1980-03-17
The last revision was dated 1980-03-17, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: NDP, MTX

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1dfr_ (-)
taflwaqnrngligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhldqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

  • Chain 'p':
    No sequence available.