PDB entry 1dfq

View 1dfq on RCSB PDB site
Description: the hc fragment of tetanus toxin complexed with sialic acid
Class: toxin
Keywords: beta trefoil, jelly-roll, toxin, carbohydrate
Deposited on 1999-11-20, released 2000-03-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetanus toxin hc
    Species: Clostridium tetani [TaxId:1513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dfqa1, d1dfqa2
  • Heterogens: SLB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dfqA (A:)
    dneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnness
    evivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgw
    svslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingv
    lmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsylsi
    tflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrlyn
    glkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyna
    pgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwyf
    nhlkdkilgcdwyfvptdegwtnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfqA (A:)
    edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
    vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
    lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
    saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsylsitfl
    rdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrlynglk
    fiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgynapgi
    plykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwyfnhl
    kdkilgcdwyfvptdegwtnd