PDB entry 1dfo

View 1dfo on RCSB PDB site
Description: crystal structure at 2.4 angstrom resolution of e. coli serine hydroxymethyltransferase in complex with glycine and 5-formyl tetrahydrofolate
Class: transferase
Keywords: alpha plp aspartate, amino transferase, (aat)-like fold
Deposited on 1999-11-20, released 1999-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfoa_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfob_
  • Chain 'C':
    Compound: serine hydroxymethyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfoc_
  • Chain 'D':
    Compound: serine hydroxymethyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfod_
  • Heterogens: PLG, FFO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dfoA (A:)
    mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
    gkryyggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
    lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
    vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
    akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
    vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
    girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfoA (A:)
    lkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegypg
    kryyggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmnl
    ahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgvv
    dwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglila
    kggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamvev
    flergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvtsg
    irvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfoB (B:)
    mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
    gkryyggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
    lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
    vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
    akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
    vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
    girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfoC (C:)
    mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
    gkryyggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
    lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
    vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
    akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
    vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
    girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dfoD (D:)
    mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
    gkryyggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
    lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
    vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
    akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
    vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
    girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfoD (D:)
    lkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegypg
    kryyggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmnl
    ahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgvv
    dwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglila
    kggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamvev
    flergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvtsg
    irvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya