PDB entry 1dfn

View 1dfn on RCSB PDB site
Description: crystal structure of defensin hnp-3, an amphiphilic dimer: mechanisms of membrane permeabilization
Class: defensin
Keywords: defensin
Deposited on 1991-01-18, released 1992-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: defensin hnp-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfna_
  • Chain 'B':
    Compound: defensin hnp-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfnA (A:)
    dcycripaciagerrygtciyqgrlwafcc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfnB (B:)
    dcycripaciagerrygtciyqgrlwafcc