PDB entry 1dfl

View 1dfl on RCSB PDB site
Description: scallop myosin s1 complexed with mgadp:vanadate-transition state
Class: contractile protein
Keywords: myosin motor, conformational changes, contractile protein
Deposited on 1999-11-19, released 2000-10-25
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.394
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dfla1, d1dfla2
  • Chain 'B':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dflb1, d1dflb2
  • Chain 'W':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dflw_
  • Chain 'X':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dflx_
  • Chain 'Y':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dfly_
  • Chain 'Z':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dflz_
  • Heterogens: CA, MG, VO4, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dflA (A:)
    fsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivads
    strtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavn
    pyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagkte
    ntkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnnssrfg
    kfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtp
    dsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfk
    qrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvvnsvg
    alakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerl
    qqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkadd
    ksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpine
    nvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknlysth
    phfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqrysila
    pnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiism
    fqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dflA (A:)
    fsdpdfqylavdqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkk
    ddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyrrlpi
    ytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentkkvim
    ylakvedqiiqanpvleaygnakttrnnnssrfgkfirihfgptgkiagadietylleks
    rvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgcltvdniddveefkl
    cdeafdilgftkeekqsmfkctasilhmgemkfkqrpreeqaesdgtaeaekvaflcgin
    agdllkallkpkvtkgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyig
    vldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlq
    mcidliekpmgilsileeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpah
    felhhyagnvpysitgwleknkdpinenvvallgaskeplvaeqtisavhreslnklmkn
    lysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqr
    ysilapnaipdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiis
    mfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dflB (B:)
    fsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivads
    strtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavn
    pyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagkte
    ntkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnnssrfg
    kfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtp
    dsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfk
    qrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvvnsvg
    alakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerl
    qqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkadd
    ksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpine
    nvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknlysth
    phfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqrysila
    pnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiism
    fqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dflB (B:)
    fsdpdfqylavdqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkk
    ddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyrrlpi
    ytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentkkvim
    ylakvedqiiqanpvleaygnakttrnnnssrfgkfirihfgptgkiagadietylleks
    rvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgcltvdniddveefkl
    cdeafdilgftkeekqsmfkctasilhmgemkfkqaesdgtaeaekvaflcginagdllk
    allkpkvtkgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiag
    feifdfnsfeqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidli
    ekpmgilsileeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhy
    agnvpysitgwleknkdpinenvvallgaskeplvaeqtisavhreslnklmknlysthp
    hfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqrysilap
    naipdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiismfqahi
    rgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1dflW (W:)
    lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
    flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
    apveggkfdyvkftamikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dflW (W:)
    kqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmfls
    ifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkeapv
    eggkfdyvkftamikg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1dflX (X:)
    lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks
    lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv
    deiikltdlqedlegnvkyedfvkkvmagpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dflX (X:)
    sqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeksl
    pfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedvd
    eiikltdlqedlegnvkyedfvkkvmagpyp
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1dflY (Y:)
    lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
    flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
    apveggkfdyvkftamikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dflY (Y:)
    kqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmfls
    ifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkeapv
    eggkfdyvkftamikg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1dflZ (Z:)
    lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks
    lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv
    deiikltdlqedlegnvkyedfvkkvmagpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dflZ (Z:)
    sqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeksl
    pfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedvd
    eiikltdlqedlegnvkyedfvkkvmagpyp