PDB entry 1dfk

View 1dfk on RCSB PDB site
Description: nucleotide-free scallop myosin s1-near rigor state
Class: contractile protein
Keywords: myosin motor, conformational changes
Deposited on 1999-11-19, released 2000-10-25
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.415
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dfka1, d1dfka2
  • Chain 'Y':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dfky_
  • Chain 'Z':
    Compound: myosin head
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dfkz_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dfkA (A:)
    sdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivadss
    trtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnp
    yrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagkten
    tkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnnssrfgk
    firihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpd
    sglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkq
    rpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvvnsvga
    lakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlq
    qffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddk
    sfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpinen
    vvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknlysthp
    hfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqrysilap
    naipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiismf
    qahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfkA (A:)
    sdpdfqylavdfdgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs
    mnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyrrlpiytdsv
    iakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentkkvimylakv
    edqiiqanpvleaygrfgkfirihfgptgkiagadietylleksrvtyqqsaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkaesdgtaeaekvaflcginagdllkallkpkmnqvvnsvgalakslydrmfnwlvr
    rvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqeey
    kkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnhmgknr
    mftkpgkpnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaskeplvaelfk
    atisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiri
    crkgfpsrliysefkqrysilapnaipgktvsekilaglqmdpaeyrlgttkvffkagvl
    gnleemrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqww
    klyskvkp
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfkY (Y:)
    lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
    flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
    apveggkfdyvkftamikg
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfkZ (Z:)
    lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks
    lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv
    deiikltdlqedlegnvkyedfvkkvmagpyp