PDB entry 1dfj

View 1dfj on RCSB PDB site
Description: ribonuclease inhibitor complexed with ribonuclease a
Deposited on 1996-06-29, released 1997-01-11
The last revision prior to the SCOP 1.59 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.59: d1dfje_
  • Chain 'I':
    Domains in SCOP 1.59: d1dfji_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfjE (E:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfjI (I:)
    mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
    nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
    gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
    garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
    elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
    esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
    sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
    gcaleqlvlydtywteevedrlqalegskpglrvis