PDB entry 1dfj

View 1dfj on RCSB PDB site
Description: ribonuclease inhibitor complexed with ribonuclease a
Class: complex (endonuclease/inhibitor)
Keywords: complex (ribonuclease/inhibitor), ribonuclease, hydrolase, leucine-rich repeats, complex (endonuclease/inhibitor) complex
Deposited on 1996-06-29, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfje_
  • Chain 'I':
    Compound: ribonuclease inhibitor
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfji_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfjE (E:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfjI (I:)
    mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
    nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
    gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
    garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
    elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
    esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
    sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
    gcaleqlvlydtywteevedrlqalegskpglrvis