PDB entry 1dfh

View 1dfh on RCSB PDB site
Description: x-ray structure of escherichia coli enoyl reductase with bound nad and thieno-diazaborine
Class: oxidoreductase
Keywords: oxidoreductase, lipid biosynthesis, diazaborine
Deposited on 1997-01-16, released 1998-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl acyl carrier protein reductase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dfha_
  • Chain 'B':
    Compound: enoyl acyl carrier protein reductase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dfhb_
  • Heterogens: NAD, TDB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dfhA (A:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfhA (A:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dfhB (B:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfhB (B:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamne