PDB entry 1dfe

View 1dfe on RCSB PDB site
Description: nmr structure of ribosomal protein l36 from thermus thermophilus
Deposited on 1999-11-19, released 1999-12-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-16, with a file datestamp of 2000-02-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dfea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfeA (A:)
    mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg