PDB entry 1dfd

View 1dfd on RCSB PDB site
Description: oxidised desulfovibrio africanus ferredoxin i, nmr, 19 structures
Deposited on 1997-12-01, released 1999-01-13
The last revision prior to the SCOP 1.59 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1dfd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfd_ (-)
    arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
    wede