PDB entry 1dfd

View 1dfd on RCSB PDB site
Description: oxidised desulfovibrio africanus ferredoxin I, nmr, 19 structures
Class: electron transport
Keywords: electron transport, oxidised desulfovibrio africanus ferredoxin I, electron-transfer protein, 4fe-4s cluster
Deposited on 1997-12-01, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: Desulfovibrio africanus [TaxId:873]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfda_
  • Heterogens: SF4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfdA (A:)
    arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
    wede