PDB entry 1dfb

View 1dfb on RCSB PDB site
Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type I
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-03-27, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.177
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa 3d6 fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dfbh1, d1dfbh2
  • Chain 'L':
    Compound: igg1-kappa 3d6 fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAA87674 (2-211)
      • conflict (30)
      • conflict (33)
      • conflict (42)
      • conflict (75)
      • conflict (86)
      • conflict (89)
      • conflict (92-94)
      • conflict (97)
      • conflict (102)
    Domains in SCOPe 2.03: d1dfbl1, d1dfbl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfbH (H:)
    evqlvesggglvqpgrslrlscaasgftfndyamhwvrqapgkglewvsgiswdsssigy
    adsvkgrftisrdnaknslylqmnslraedmalyycvkgrdyydsggyftvafdiwgqgt
    mvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfbL (L:)
    diqmtqspstlsasvgdrvtitcrasqsisrwlawyqqkpgkvpklliykasslesgvps
    rfsgsgsgteftltisslqpddfatyycqqynsysfgpgtkvdikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrgec