PDB entry 1dfa

View 1dfa on RCSB PDB site
Description: crystal structure of pi-scei in c2 space group
Deposited on 1999-11-18, released 1999-12-08
The last revision prior to the SCOP 1.71 freeze date was dated 2000-02-16, with a file datestamp of 2000-02-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dfaA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfaA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisekayfewtieardlsllgshvrkatyqtyapilyendhffdymqlti
    egpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeykntenplwda
    ivglgflkdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdg
    lvslarslglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapa
    aafarecrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn