PDB entry 1df9

View 1df9 on RCSB PDB site
Description: dengue virus ns3-protease complexed with mung-bean bowman-birk inhibitor
Deposited on 1999-11-18, released 2000-08-23
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1df9a_
  • Chain 'B':
    Domains in SCOP 1.59: d1df9b_
  • Chain 'C':
    Domains in SCOP 1.59: d1df9c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1df9A (A:)
    wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
    iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
    avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1df9B (B:)
    wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
    iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
    avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1df9C (C:)
    shdepsessepccdscdctksippqchcanirlnschsackscictrsmpgkcrcldtdd
    fcykpcesmdkd