PDB entry 1df8

View 1df8 on RCSB PDB site
Description: s45a mutant of streptavidin in complex with biotin
Class: binding protein
Keywords: biotin binding protein, biotin, binding protein
Deposited on 1999-11-18, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.169
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (streptavidin)
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (32)
    Domains in SCOPe 2.07: d1df8a_
  • Chain 'B':
    Compound: protein (streptavidin)
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (32)
    Domains in SCOPe 2.07: d1df8b_
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1df8A (A:)
    aeagitgtwynqlgstfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df8A (A:)
    gitgtwynqlgstfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1df8B (B:)
    aeagitgtwynqlgstfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df8B (B:)
    gitgtwynqlgstfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp