PDB entry 1df7

View 1df7 on RCSB PDB site
Description: dihydrofolate reductase of mycobacterium tuberculosis complexed with nadph and methotrexate
Class: oxidoreductase
Keywords: dihydrofolate reductase, structure-based inhibitor design, folateanalogs, rossmann fold, nicotinamide adenine dinucleotide, methotrexate, tuberculosis, oxidoreductase
Deposited on 1999-11-17, released 2000-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1df7a_
  • Heterogens: SO4, NDP, MTX, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1df7A (A:)
    mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
    rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
    reagdalapvldetwrgetgewrfsrsglryrlysyhrs