PDB entry 1df5

View 1df5 on RCSB PDB site
Description: interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Deposited on 1999-11-17, released 1999-11-24
The last revision prior to the SCOP 1.63 freeze date was dated 2000-01-26, with a file datestamp of 2000-01-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.183
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1df5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1df5A (A:)
  sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
  esqnqqek