PDB entry 1df5

View 1df5 on RCSB PDB site
Description: interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Deposited on 1999-11-17, released 1999-11-24
The last revision was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.183
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 envelope glycoprotein gp41
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04578 (40-67)
      • see remark 999 (34-39)

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1df5A (A:)
sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
esqnqqek