PDB entry 1df4

View 1df4 on RCSB PDB site
Description: interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Class: viral protein
Keywords: HIV-1, GP41, MEMBRANE FUSION, PROTEIN-DETERGENT INTERACTION, Viral protein
Deposited on 1999-11-17, released 1999-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 envelope glycoprotein gp41
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04578 (40-End)
      • see remark 999 (38-39)
    Domains in SCOPe 2.07: d1df4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1df4A (A:)
    sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
    esqnqqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df4A (A:)
    ivqqqnnllraieaqqhllqltvwgikqlqaggwmewdreinnytslihslieesqn