PDB entry 1df3

View 1df3 on RCSB PDB site
Description: solution structure of a recombinant mouse major urinary protein
Class: transport protein
Keywords: lipocalin, carrier protein, pheromone, 8-stranded beta-barrel, binding pocket, disulfide bridge (64-157), signaling protein, transport protein
Deposited on 1999-11-17, released 2000-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major urinary protein
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11589 (0-161)
    • conflict (135)
  Domains in SCOPe 2.08: d1df3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1df3A (A:)
  eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
  deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
  grepdlssdikerfaqlceehgilreniidlsnanrclqare