PDB entry 1df1

View 1df1 on RCSB PDB site
Description: murine inosoxy dimer with isothiourea bound in the active site
Class: oxidoreductase
Keywords: nitric oxide l-arginine monooxygenase, nos, heme, isothiourea, inos, oxidoreductase
Deposited on 1999-11-16, released 1999-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.223
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1df1a_
  • Chain 'B':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1df1b_
  • Heterogens: ZN, HEM, H4B, ITU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1df1A (A:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    nek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df1A (A:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1df1B (B:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    nek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df1B (B:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq