PDB entry 1df0

View 1df0 on RCSB PDB site
Description: crystal structure of m-calpain
Deposited on 1999-11-16, released 2000-06-21
The last revision prior to the SCOP 1.61 freeze date was dated 2001-11-26, with a file datestamp of 2001-11-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1df0A (A:)
    agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpsfpalpsslgfk
    elgpyssktrgiewkrpteicadpqfiiggatrtdicqgalgdswllaaiasltlneeil
    arvvpldqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
    ekayakingcyealsggattegfedftggiaewyelrkpppnlfkiiqkalekgsllgcs
    iditsaadseavtyqklvkghaysvtgaeevessgslqklirirnpwgqvewtgkwndnc
    pswntvdpevranlterqedgefwmsfsdflrhysrleicnltpdtltcdsykkwkltkm
    dgnwrrgstaggcrnypntfwmnpqylikleeededdedgergctflvgliqkhrrrqrk
    mgedmhtigfgiyevpeeltgqtnihlsknfflttrarersdtfinlrevlnrfklppge
    yvlvpstfephkngdfcirvfsekkadyqtvddeieanieeieaneedigdgfrrlfaql
    agedaeisafelqtilrrvlakrediksdgfsietckimvdmldedgsgklglkefyilw
    tkiqkyqkiyreidvdrsgtmnsyemrkaleeagfklpcqlhqvivarfaddeliidfdn
    fvrclvrleilfkifkqldpentgtiqldliswlsfsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df0A (A:)
    agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpsfpalpsslgfk
    elgpyssktrgiewkrpteicadpqfiiggatrtdicqgalgdswllaaiasltlneeil
    arvvpldqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
    ekayakingcyealsggattegfedftggiaewyelrkpppnlfkiiqkalekgsllgcs
    idighaysvtgaeevqklirirnpwgqgefwmsfsdflrhysrleicnltpdtltcdsyk
    kwkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededdedgrgctflvgliqkh
    rrrqrkmgedmhtigfgiyevsknffltersdtfinlrevlnrfklppgeyvlvpstfep
    hkngdfcirvfsekkadyqtvddeieanieeianeedigdgfrrlfaqlagedaeisafe
    lqtilrrvlakksdgfsietckimvdmldedgsgklglkefyilwtkiqkyqkiyreidv
    drsgtmnsyemrkaleeagfklpcqlhqvivarfaddeliidfdnfvrclvrleilfkif
    kqldpentgtiqldliswlsfsvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1df0B (B:)
    neseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd
    sdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysm
    iirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys