PDB entry 1df0

View 1df0 on RCSB PDB site
Description: Crystal structure of M-Calpain
Class: hydrolase
Keywords: cysteine protease, calmodulin, papain, catalytic triad, zymogen activation, c2 domain, protease, zymogen, calpain, hydrolase
Deposited on 1999-11-16, released 2000-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m-calpain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07009 (Start-699)
      • engineered (104)
    Domains in SCOPe 2.07: d1df0a1, d1df0a2, d1df0a3
  • Chain 'B':
    Compound: calpain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1df0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1df0A (A:)
    magiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpsfpalpsslgf
    kelgpyssktrgiewkrpteicadpqfiiggatrtdicqgalgdswllaaiasltlneei
    larvvpldqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsal
    lekayakingcyealsggattegfedftggiaewyelrkpppnlfkiiqkalekgsllgc
    siditsaadseavtyqklvkghaysvtgaeevessgslqklirirnpwgqvewtgkwndn
    cpswntvdpevranlterqedgefwmsfsdflrhysrleicnltpdtltcdsykkwkltk
    mdgnwrrgstaggcrnypntfwmnpqylikleeededdedgergctflvgliqkhrrrqr
    kmgedmhtigfgiyevpeeltgqtnihlsknfflttrarersdtfinlrevlnrfklppg
    eyvlvpstfephkngdfcirvfsekkadyqtvddeieanieeieaneedigdgfrrlfaq
    lagedaeisafelqtilrrvlakrediksdgfsietckimvdmldedgsgklglkefyil
    wtkiqkyqkiyreidvdrsgtmnsyemrkaleeagfklpcqlhqvivarfaddeliidfd
    nfvrclvrleilfkifkqldpentgtiqldliswlsfsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df0A (A:)
    agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpsfpalpsslgfk
    elgpyssktrgiewkrpteicadpqfiiggatrtdicqgalgdswllaaiasltlneeil
    arvvpldqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
    ekayakingcyealsggattegfedftggiaewyelrkpppnlfkiiqkalekgsllgcs
    idighaysvtgaeevqklirirnpwgqgefwmsfsdflrhysrleicnltpdtltcdsyk
    kwkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededdedgrgctflvgliqkh
    rrrqrkmgedmhtigfgiyevsknffltersdtfinlrevlnrfklppgeyvlvpstfep
    hkngdfcirvfsekkadyqtvddeieanieeianeedigdgfrrlfaqlagedaeisafe
    lqtilrrvlakksdgfsietckimvdmldedgsgklglkefyilwtkiqkyqkiyreidv
    drsgtmnsyemrkaleeagfklpcqlhqvivarfaddeliidfdnfvrclvrleilfkif
    kqldpentgtiqldliswlsfsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1df0B (B:)
    mhysnieaneseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
    rsmvavmdsdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfh
    lnqhiysmiirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlql
    tmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df0B (B:)
    neseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd
    sdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysm
    iirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys