PDB entry 1dew

View 1dew on RCSB PDB site
Description: crystal structure of human ape1 bound to abasic dna
Deposited on 1999-11-15, released 2000-02-02
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.195
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1dewa_
  • Chain 'B':
    Domains in SCOP 1.69: d1dewb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dewA (A:)
    egpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
    senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv
    aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
    lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
    wrldyfllshsllpalcdskirskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dewA (A:)
    gpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcs
    enklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviva
    efdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidl
    rnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgw
    rldyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dewB (B:)
    egpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
    senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv
    aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
    lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
    wrldyfllshsllpalcdskirskalgsdhcpitlylal