PDB entry 1deu

View 1deu on RCSB PDB site
Description: crystal structure of human procathepsin x: a cysteine protease with the proregion covalently linked to the active site cysteine
Class: hydrolase
Keywords: cysteine protease, procathepsin x, proregion, prosegment, hydrolase
Deposited on 1999-11-15, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: procathepsin x
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBR2 (38-276)
      • conflict (59)
      • see remark 999 (102)
      • conflict (123)
    Domains in SCOPe 2.07: d1deua_
  • Chain 'B':
    Compound: procathepsin x
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBR2 (38-276)
      • conflict (59)
      • see remark 999 (102)
      • conflict (123)
    Domains in SCOPe 2.07: d1deub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1deuA (A:)
    frrgqtcyrplrgdglaplgrttyprpheylspadlpkswdwrnvdgvnyasitrnqhip
    qycgscwahastsamadrinikrkgawpstllsvqnvidcgnagsceggndlsvwdyahq
    hgipdetcnnyqakdqecdkfnqcgtcnefkechairnytlwrvgdygslsgrekmmaei
    yangpiscgimaterlanytggiyaeyqdttyinhvvsvagwgisdgteywivrnswgep
    wgergwlrivtstykdgkgarynlaieehctfgdpiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deuA (A:)
    rgqtcyrplrgdglaplgrttyprpheylspadlpkswdwrnvdgvnyasitrnqhipqy
    cgscwahastsamadrinikrkgawpstllsvqnvidcgnagsceggndlsvwdyahqhg
    ipdetcnnyqakdqecdkfnqcgtcnefkechairnytlwrvgdygslsgrekmmaeiya
    ngpiscgimaterlanytggiyaeyqdttyinhvvsvagwgisdgteywivrnswgepwg
    ergwlrivtstykdgkgarynlaieehctfgdpiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1deuB (B:)
    frrgqtcyrplrgdglaplgrttyprpheylspadlpkswdwrnvdgvnyasitrnqhip
    qycgscwahastsamadrinikrkgawpstllsvqnvidcgnagsceggndlsvwdyahq
    hgipdetcnnyqakdqecdkfnqcgtcnefkechairnytlwrvgdygslsgrekmmaei
    yangpiscgimaterlanytggiyaeyqdttyinhvvsvagwgisdgteywivrnswgep
    wgergwlrivtstykdgkgarynlaieehctfgdpiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deuB (B:)
    frrgqtcyrplreylspadlpkswdwrnvdgvnyasitrnqhipqycgscwahastsama
    drinikrkgawpstllsvqnvidcgnagsceggndlsvwdyahqhgipdetcnnyqakdq
    ecdkfnqcgtcnefkechairnytlwrvgdygslsgrekmmaeiyangpiscgimaterl
    anytggiyaeyqdttyinhvvsvagwgisdgteywivrnswgepwgergwlrivtstykd
    gkgarynlaieehctfgdpiv