PDB entry 1det

View 1det on RCSB PDB site
Description: ribonuclease t1 carboxymethylated at glu 58 in complex with 2'gmp
Class: hydrolase (endoribonuclease)
Keywords: hydrolase, endoribonuclease, nuclease, endonuclease, signal, hydrolase (endoribonuclease)
Deposited on 1996-02-20, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease t1
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1deta_
  • Heterogens: NA, 2GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1detA (A:)
    acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect