PDB entry 1deq

View 1deq on RCSB PDB site
Description: the crystal structure of modified bovine fibrinogen (at ~4 angstrom resolution)
Class: blood clotting
Keywords: coiled-coil, blood clotting
Deposited on 1999-11-15, released 2000-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.257
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen (alpha chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqa_
  • Chain 'B':
    Compound: fibrinogen (beta chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqb_
  • Chain 'C':
    Compound: fibrinogen (gamma chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqc_
  • Chain 'D':
    Compound: fibrinogen (alpha chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqd_
  • Chain 'E':
    Compound: fibrinogen (beta chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqe_
  • Chain 'F':
    Compound: fibrinogen (gamma chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqf_
  • Chain 'M':
    Compound: fibrinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DEQ (0-89)
    Domains in SCOPe 2.07: d1deqm_
  • Chain 'N':
    Compound: fibrinogen (alpha chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqn_
  • Chain 'O':
    Compound: fibrinogen (beta chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqo_
  • Chain 'P':
    Compound: fibrinogen (gamma chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqp_
  • Chain 'Q':
    Compound: fibrinogen (alpha chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqq_
  • Chain 'R':
    Compound: fibrinogen (beta chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqr_
  • Chain 'S':
    Compound: fibrinogen (gamma chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deqs_
  • Chain 'Z':
    Compound: fibrinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DEQ (0-89)
    Domains in SCOPe 2.07: d1deqz_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1deqA (A:)
    edgsdppsgdfltegggvrgprlverqqsacketgwpfcsdedwntkcpsgcrmkglide
    vdqdftsrinklrdslfnyqknskdsntltknivelmrgdfakannndntfkqinedlrs
    rieilrrkvieqvqrinllqknvrdqlvdmkrlevdidikirsckgscsralehkvdled
    yknqqkqleqviainllpsrdiqylpilkmstitgpvprefksqlqeaplewkallemqq
    tkmvletfggdghargdsvsqgtglapgsprkpgtssignvnpgsygpgssgtwnpgrpe
    pgsagtwnpgrpepgsagtwnpgrpepgsagtwnpgrpepgsagtwnpgrpepgsagtwn
    tgssgsssfrpdssghgnirpsspdwgtfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqA (A:)
    ntkcpsgcrmkglidevdqdftsrinklrdslfnyqknskdsntltknivelmrgdfaka
    nnndntfkqinedlrsrieilrrkvieqvqrinllqknvrdqlvdmkrlevdidikirsc
    kgscsralehkvdledyknqqkqleqviainllpsrdiqylpilkmstitgpvprefksq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1deqB (B:)
    kverkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsvsrtsss
    tfqyitllknmwkgrqnqvqdnenvvneysshlekhqlyidetvknniptklrvlrsile
    nlrskiqklesdvstqmeycrtpctvtcnipvvsgkecekiirnegetsemyliqpedss
    kpyrvycdmktekggwtviqnrqdgsvdfgrkwdpykqgfgniatnaegkkycgvpgeyw
    lgndrisqltnmgptklliemedwkgdkvtalyegftvqneankyqlsvskykgtagnal
    iegasqlvgenrtmtihnsmffstydrdndgwkttdprkqcskedgggwwynrchaanpn
    gryywggaytwdmakhgtddgvvwmnwqgswysmkkmskmirpyfpeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqB (B:)
    klqdtlvrqerpirksiedlrntvdsvsrtssstfqyitllknmwkgrqnqvqdnenvvn
    eysshlekhqlyidetvknniptklrvlrsilenlrskiqklesdvstqmeycrtpctvt
    cnipvvsgkecekiirnegetsemyliqpedsskpyrvycdmktekggwtviqnrqdgsv
    dfgrkwdpykqgfgniatnaegkkycgvpgeywlgndrisqltnmgptklliemedwkgd
    kvtalyegftvqneankyqlsvskykgtagnaliegasqlvgenrtmtihnsmffstydr
    dndgwkttdprkqcskedgggwwynrchaanpngryywggaytwdmakhgtddgvvwmnw
    qgswysmkkmskmirpyfpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1deqC (C:)
    yvatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegilyqvenktsearel
    vkaiqisynpdqpskpnniesatknsksmmeeimkyetlisthestirflqeiynsnsqk
    ivnlrdkvvqleancqepcqdtvkihdvtgrdcqdvankgakesglyfirplkakqqflv
    yceidgsgngwtvfqkrldgsldfkknwiqykegfghlsptgntefwlgnekihlistqs
    tipyvlriqledwngrtstadyasfkvtgendkyrltyayfiggdagdafdgydfgddss
    dkfftshngmqfstwdsdndkydgncaeqdgsgwwmnkchaghlngvyyqggtysktstp
    ngydngiiwatwksrwysmkkttmkiiplnrlaigegqqhqlggakqagdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqC (C:)
    dflnnyqtsvdkdlrtlegilyqvenktsearelvkaiqisynpdqpskpnniesatkns
    ksmmeeimkyetlisthestirflqeiynsnsqkivnlrdkvvqleancqepcqdtvkih
    dvtgrdcqdvankgakesglyfirplkakqqflvyceidgsgngwtvfqkrldgsldfkk
    nwiqykegfghlsptgntefwlgnekihlistqstipyvlriqledwngrtstadyasfk
    vtgendkyrltyayfiggdagdafdgydfgddssdkfftshngmqfstwdsdndkydgnc
    aeqdgsgwwmnkchaghlngvyyqggtysktstpngydngiiwatwksrwysmkkttmki
    iplnrlaige
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1deqD (D:)
    edgsdppsgdfltegggvrgprlverqqsacketgwpfcsdedwntkcpsgcrmkglide
    vdqdftsrinklrdslfnyqknskdsntltknivelmrgdfakannndntfkqinedlrs
    rieilrrkvieqvqrinllqknvrdqlvdmkrlevdidikirsckgscsralehkvdled
    yknqqkqleqviainllpsrdiqylpilkmstitgpvprefksqlqeaplewkallemqq
    tkmvletfggdghargdsvsqgtglapgsprkpgtssignvnpgsygpgssgtwnpgrpe
    pgsagtwnpgrpepgsagtwnpgrpepgsagtwnpgrpepgsagtwnpgrpepgsagtwn
    tgssgsssfrpdssghgnirpsspdwgtfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqD (D:)
    ntkcpsgcrmkglidevdqdftsrinklrdslfnyqknskdsntltknivelmrgdfaka
    nnndntfkqinedlrsrieilrrkvieqvqrinllqknvrdqlvdmkrlevdidikirsc
    kgscsralehkvdledyknqqkqleqviainllpsrdiqylpilkmstitgpvprefksq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1deqE (E:)
    kverkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsvsrtsss
    tfqyitllknmwkgrqnqvqdnenvvneysshlekhqlyidetvknniptklrvlrsile
    nlrskiqklesdvstqmeycrtpctvtcnipvvsgkecekiirnegetsemyliqpedss
    kpyrvycdmktekggwtviqnrqdgsvdfgrkwdpykqgfgniatnaegkkycgvpgeyw
    lgndrisqltnmgptklliemedwkgdkvtalyegftvqneankyqlsvskykgtagnal
    iegasqlvgenrtmtihnsmffstydrdndgwkttdprkqcskedgggwwynrchaanpn
    gryywggaytwdmakhgtddgvvwmnwqgswysmkkmskmirpyfpeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqE (E:)
    klqdtlvrqerpirksiedlrntvdsvsrtssstfqyitllknmwkgrqnqvqdnenvvn
    eysshlekhqlyidetvknniptklrvlrsilenlrskiqklesdvstqmeycrtpctvt
    cnipvvsgkecekiirnegetsemyliqpedsskpyrvycdmktekggwtviqnrqdgsv
    dfgrkwdpykqgfgniatnaegkkycgvpgeywlgndrisqltnmgptklliemedwkgd
    kvtalyegftvqneankyqlsvskykgtagnaliegasqlvgenrtmtihnsmffstydr
    dndgwkttdprkqcskedgggwwynrchaanpngryywggaytwdmakhgtddgvvwmnw
    qgswysmkkmskmirpyfpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1deqF (F:)
    yvatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegilyqvenktsearel
    vkaiqisynpdqpskpnniesatknsksmmeeimkyetlisthestirflqeiynsnsqk
    ivnlrdkvvqleancqepcqdtvkihdvtgrdcqdvankgakesglyfirplkakqqflv
    yceidgsgngwtvfqkrldgsldfkknwiqykegfghlsptgntefwlgnekihlistqs
    tipyvlriqledwngrtstadyasfkvtgendkyrltyayfiggdagdafdgydfgddss
    dkfftshngmqfstwdsdndkydgncaeqdgsgwwmnkchaghlngvyyqggtysktstp
    ngydngiiwatwksrwysmkkttmkiiplnrlaigegqqhqlggakqagdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqF (F:)
    dflnnyqtsvdkdlrtlegilyqvenktsearelvkaiqisynpdqpskpnniesatkns
    ksmmeeimkyetlisthestirflqeiynsnsqkivnlrdkvvqleancqepcqdtvkih
    dvtgrdcqdvankgakesglyfirplkakqqflvyceidgsgngwtvfqkrldgsldfkk
    nwiqykegfghlsptgntefwlgnekihlistqstipyvlriqledwngrtstadyasfk
    vtgendkyrltyayfiggdagdafdgydfgddssdkfftshngmqfstwdsdndkydgnc
    aeqdgsgwwmnkchaghlngvyyqggtysktstpngydngiiwatwksrwysmkkttmki
    iplnrlaige
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deqM (M:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1deqN (N:)
    edgsdppsgdfltegggvrgprlverqqsacketgwpfcsdedwntkcpsgcrmkglide
    vdqdftsrinklrdslfnyqknskdsntltknivelmrgdfakannndntfkqinedlrs
    rieilrrkvieqvqrinllqknvrdqlvdmkrlevdidikirsckgscsralehkvdled
    yknqqkqleqviainllpsrdiqylpilkmstitgpvprefksqlqeaplewkallemqq
    tkmvletfggdghargdsvsqgtglapgsprkpgtssignvnpgsygpgssgtwnpgrpe
    pgsagtwnpgrpepgsagtwnpgrpepgsagtwnpgrpepgsagtwnpgrpepgsagtwn
    tgssgsssfrpdssghgnirpsspdwgtfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqN (N:)
    ntkcpsgcrmkglidevdqdftsrinklrdslfnyqknskdsntltknivelmrgdfaka
    nnndntfkqinedlrsrieilrrkvieqvqrinllqknvrdqlvdmkrlevdidikirsc
    kgscsralehkvdledyknqqkqleqviainllpsrdiqylpilkmstitgpvprefksq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1deqO (O:)
    kverkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsvsrtsss
    tfqyitllknmwkgrqnqvqdnenvvneysshlekhqlyidetvknniptklrvlrsile
    nlrskiqklesdvstqmeycrtpctvtcnipvvsgkecekiirnegetsemyliqpedss
    kpyrvycdmktekggwtviqnrqdgsvdfgrkwdpykqgfgniatnaegkkycgvpgeyw
    lgndrisqltnmgptklliemedwkgdkvtalyegftvqneankyqlsvskykgtagnal
    iegasqlvgenrtmtihnsmffstydrdndgwkttdprkqcskedgggwwynrchaanpn
    gryywggaytwdmakhgtddgvvwmnwqgswysmkkmskmirpyfpeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqO (O:)
    klqdtlvrqerpirksiedlrntvdsvsrtssstfqyitllknmwkgrqnqvqdnenvvn
    eysshlekhqlyidetvknniptklrvlrsilenlrskiqklesdvstqmeycrtpctvt
    cnipvvsgkecekiirnegetsemyliqpedsskpyrvycdmktekggwtviqnrqdgsv
    dfgrkwdpykqgfgniatnaegkkycgvpgeywlgndrisqltnmgptklliemedwkgd
    kvtalyegftvqneankyqlsvskykgtagnaliegasqlvgenrtmtihnsmffstydr
    dndgwkttdprkqcskedgggwwynrchaanpngryywggaytwdmakhgtddgvvwmnw
    qgswysmkkmskmirpyfpe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1deqP (P:)
    yvatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegilyqvenktsearel
    vkaiqisynpdqpskpnniesatknsksmmeeimkyetlisthestirflqeiynsnsqk
    ivnlrdkvvqleancqepcqdtvkihdvtgrdcqdvankgakesglyfirplkakqqflv
    yceidgsgngwtvfqkrldgsldfkknwiqykegfghlsptgntefwlgnekihlistqs
    tipyvlriqledwngrtstadyasfkvtgendkyrltyayfiggdagdafdgydfgddss
    dkfftshngmqfstwdsdndkydgncaeqdgsgwwmnkchaghlngvyyqggtysktstp
    ngydngiiwatwksrwysmkkttmkiiplnrlaigegqqhqlggakqagdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqP (P:)
    dflnnyqtsvdkdlrtlegilyqvenktsearelvkaiqisynpdqpskpnniesatkns
    ksmmeeimkyetlisthestirflqeiynsnsqkivnlrdkvvqleancqepcqdtvkih
    dvtgrdcqdvankgakesglyfirplkakqqflvyceidgsgngwtvfqkrldgsldfkk
    nwiqykegfghlsptgntefwlgnekihlistqstipyvlriqledwngrtstadyasfk
    vtgendkyrltyayfiggdagdafdgydfgddssdkfftshngmqfstwdsdndkydgnc
    aeqdgsgwwmnkchaghlngvyyqggtysktstpngydngiiwatwksrwysmkkttmki
    iplnrlaige
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1deqQ (Q:)
    edgsdppsgdfltegggvrgprlverqqsacketgwpfcsdedwntkcpsgcrmkglide
    vdqdftsrinklrdslfnyqknskdsntltknivelmrgdfakannndntfkqinedlrs
    rieilrrkvieqvqrinllqknvrdqlvdmkrlevdidikirsckgscsralehkvdled
    yknqqkqleqviainllpsrdiqylpilkmstitgpvprefksqlqeaplewkallemqq
    tkmvletfggdghargdsvsqgtglapgsprkpgtssignvnpgsygpgssgtwnpgrpe
    pgsagtwnpgrpepgsagtwnpgrpepgsagtwnpgrpepgsagtwnpgrpepgsagtwn
    tgssgsssfrpdssghgnirpsspdwgtfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqQ (Q:)
    ntkcpsgcrmkglidevdqdftsrinklrdslfnyqknskdsntltknivelmrgdfaka
    nnndntfkqinedlrsrieilrrkvieqvqrinllqknvrdqlvdmkrlevdidikirsc
    kgscsralehkvdledyknqqkqleqviainllpsrdiqylpilkmstitgpvprefksq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1deqR (R:)
    kverkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsvsrtsss
    tfqyitllknmwkgrqnqvqdnenvvneysshlekhqlyidetvknniptklrvlrsile
    nlrskiqklesdvstqmeycrtpctvtcnipvvsgkecekiirnegetsemyliqpedss
    kpyrvycdmktekggwtviqnrqdgsvdfgrkwdpykqgfgniatnaegkkycgvpgeyw
    lgndrisqltnmgptklliemedwkgdkvtalyegftvqneankyqlsvskykgtagnal
    iegasqlvgenrtmtihnsmffstydrdndgwkttdprkqcskedgggwwynrchaanpn
    gryywggaytwdmakhgtddgvvwmnwqgswysmkkmskmirpyfpeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqR (R:)
    klqdtlvrqerpirksiedlrntvdsvsrtssstfqyitllknmwkgrqnqvqdnenvvn
    eysshlekhqlyidetvknniptklrvlrsilenlrskiqklesdvstqmeycrtpctvt
    cnipvvsgkecekiirnegetsemyliqpedsskpyrvycdmktekggwtviqnrqdgsv
    dfgrkwdpykqgfgniatnaegkkycgvpgeywlgndrisqltnmgptklliemedwkgd
    kvtalyegftvqneankyqlsvskykgtagnaliegasqlvgenrtmtihnsmffstydr
    dndgwkttdprkqcskedgggwwynrchaanpngryywggaytwdmakhgtddgvvwmnw
    qgswysmkkmskmirpyfpe
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1deqS (S:)
    yvatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegilyqvenktsearel
    vkaiqisynpdqpskpnniesatknsksmmeeimkyetlisthestirflqeiynsnsqk
    ivnlrdkvvqleancqepcqdtvkihdvtgrdcqdvankgakesglyfirplkakqqflv
    yceidgsgngwtvfqkrldgsldfkknwiqykegfghlsptgntefwlgnekihlistqs
    tipyvlriqledwngrtstadyasfkvtgendkyrltyayfiggdagdafdgydfgddss
    dkfftshngmqfstwdsdndkydgncaeqdgsgwwmnkchaghlngvyyqggtysktstp
    ngydngiiwatwksrwysmkkttmkiiplnrlaigegqqhqlggakqagdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deqS (S:)
    dflnnyqtsvdkdlrtlegilyqvenktsearelvkaiqisynpdqpskpnniesatkns
    ksmmeeimkyetlisthestirflqeiynsnsqkivnlrdkvvqleancqepcqdtvkih
    dvtgrdcqdvankgakesglyfirplkakqqflvyceidgsgngwtvfqkrldgsldfkk
    nwiqykegfghlsptgntefwlgnekihlistqstipyvlriqledwngrtstadyasfk
    vtgendkyrltyayfiggdagdafdgydfgddssdkfftshngmqfstwdsdndkydgnc
    aeqdgsgwwmnkchaghlngvyyqggtysktstpngydngiiwatwksrwysmkkttmki
    iplnrlaige
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deqZ (Z:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx