PDB entry 1deo

View 1deo on RCSB PDB site
Description: rhamnogalacturonan acetylesterase from aspergillus aculeatus at 1.55 a resolution with so4 in the active site
Class: hydrolase
Keywords: sgnh hydrolase, hydrolase
Deposited on 1999-11-15, released 2000-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhamnogalacturonan acetylesterase
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • EMBL Q00017 (0-232)
    Domains in SCOPe 2.07: d1deoa_
  • Heterogens: NAG, BMA, MAN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deoA (A:)
    ttvylagdstmakngggsgtngwgeylasylsatvvndavagrsarsytregrfeniadv
    vtagdyvivefghndggslstdngrtdcsgtgaevcysvydgvnetiltfpaylenaakl
    ftakgakvilssqtpnnpwetgtfvnsptrfveyaelaaevagveyvdhwsyvdsiyetl
    gnatvnsyfpidhthtspagaevvaeaflkavvctgtslksvltttsfegtcl