PDB entry 1den

View 1den on RCSB PDB site
Description: proteinase inhibitor homologues as potassium channel blockers
Class: venom(potassium channel inhibitor)
Keywords: venom(potassium channel inhibitor)
Deposited on 1994-03-07, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dendrotoxin I
    Species: Dendroaspis polylepis polylepis [TaxId:8620]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dena_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1denA (A:)
    qplrklcilhrnpgrcyqkipafyynqkkkqcegftwsgcggnsnrfktieecrrtcirk