PDB entry 1dek

View 1dek on RCSB PDB site
Description: deoxynucleoside monophosphate kinase complexed with deoxy-gmp
Class: phosphotransferase
Keywords: transferase, phosphotransferase
Deposited on 1996-01-09, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxynucleoside monophosphate kinase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04531 (0-240)
      • modified residue (54)
    Domains in SCOPe 2.07: d1deka_
  • Chain 'B':
    Compound: deoxynucleoside monophosphate kinase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04531 (0-240)
      • modified residue (54)
    Domains in SCOPe 2.07: d1dekb_
  • Heterogens: MG, DGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dekA (A:)
    mkliflsgvkrsgkdttadfimsnysavkyqlagpikdalayawgvfaantdypcltrke
    fegidydretnlnltklevitimeqafcylngkspikgvfvfddegkesvnfvafnkitd
    vinniedqwsvrrlmqalgtdlivnnfdrmywvklfaldyldkfnsgydyyivpdtrqdh
    emdaaramgatvihvvrpgqksndthiteaglpirdgdlvitndgsleelfskikntlkv
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dekB (B:)
    mkliflsgvkrsgkdttadfimsnysavkyqlagpikdalayawgvfaantdypcltrke
    fegidydretnlnltklevitimeqafcylngkspikgvfvfddegkesvnfvafnkitd
    vinniedqwsvrrlmqalgtdlivnnfdrmywvklfaldyldkfnsgydyyivpdtrqdh
    emdaaramgatvihvvrpgqksndthiteaglpirdgdlvitndgsleelfskikntlkv
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dekB (B:)
    mkliflsgvkrsgkdttadfimsnysavkyqlagpikdalayawgvfaantdypcltrke
    fegidydretnlnltklevitimeqafcylngkspikgvfvfddegkesvnfvafnkitd
    vinniedqwsvrrlmqalgtdlivnnfdrmywvklfaldyldkfnsgydyyivpdtrqdh
    emdaaramgatvihvvrpgaglpirdgdlvitndgsleelfskikntlkvl