PDB entry 1dej

View 1dej on RCSB PDB site
Description: crystal structure of a dictyostelium/tetrahymena chimera actin (mutant 646: q228k/t229a/a230y/a231k/s232e/e360h) in complex with human gelsolin segment 1
Class: contractile protein
Keywords: actin mutant, contractile protein
Deposited on 1999-11-15, released 2000-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: -1.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chimeric actin
    Species: Dictyostelium discoideum, Tetrahymena thermophila [TaxId:44689,5911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07830 (0-374)
      • see remark 999 (359)
      • modified residue (72)
    Domains in SCOPe 2.08: d1deja1, d1deja2
  • Chain 'S':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06396 (3-126)
      • engineered (34)
      • expression artifact (0-2)
    Domains in SCOPe 2.08: d1dejs_
  • Heterogens: CA, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dejA (A:)
    dgedvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqs
    krgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmt
    qimfetfntpamyvaiqavlslyasgrttgivmdsgdgvshtvpiyegyalphailrldl
    agrdltdymmkiltergysftttaereivrdikeklayvaldfeaemkaykessaleksy
    elpdgqvitignerfrcpealfqpsflgmesagihettynsimkcdvdirkdlygnvvls
    ggttmfpgiadrmnkeltalapstmkikiiapperkysvwiggsilaslstfqqmwiskh
    eydesgpsivhrkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dejA (A:)
    dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl
    kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
    ntpamyvaiqavlslyasgrttgivmdsgdgvshtvpiyegyalphailrldlagrdltd
    ymmkiltergysftttaereivrdikeklayvaldfeaemkaykessaleksyelpdgqv
    itignerfrcpealfqpsflgmesagihettynsimkcdvdirkdlygnvvlsggttmfp
    giadrmnkeltalapstmkikiiapperkysvwiggsilaslstfqqmwiskheydesgp
    sivhrkcf
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dejS (S:)
    mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq
    ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk
    ggvasgf