PDB entry 1deh

View 1deh on RCSB PDB site
Description: crystallization of human beta1 alcohol dehydrogenase (15 mg/ml) in 50 mm sodium phosphate (ph 7.5), 2.0 mm nad+ and 1 mm 4-iodopyrazole at 25 oc, 13% (w/v) peg 8000
Class: oxidoreductase
Keywords: nad+ dependent alcohol dehydrogenase, oxidoreductase
Deposited on 1995-10-14, released 1996-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human beta1 alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN BETA1 CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1deha1, d1deha2
  • Chain 'B':
    Compound: human beta1 alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN BETA1 CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dehb1, d1dehb2
  • Heterogens: ZN, CL, NAD, PYZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dehA (A:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dehB (B:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf