PDB entry 1deg

View 1deg on RCSB PDB site
Description: the linker of des-glu84 calmodulin is bent as seen in the crystal structure
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-06-07, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.23
AEROSPACI score: -1.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02593 (0-141)
  Domains in SCOPe 2.08: d1dega_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1degA (A:)
  teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid
  fpefltmmarkmkdtdseeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemi
  reanidgdgqvnyeefvqmmta